Semaglutide
A 31-amino-acid GLP-1 receptor agonist with structural modifications for extended half-life. One of the most-studied incretin-class compounds in current research.
Available formats
3mg vial (lyophilized)
SEMA-3MG
5mg vial (lyophilized)
SEMA-5MG
10mg vial (lyophilized)
SEMA-10MG
To place a research order, contact info@paradisecompounds.com.
Chemical Identity
| CAS Number | 910463-68-2 |
|---|---|
| Molecular Formula | C187H291N45O59 |
| Molecular Weight | 4113.58 g/mol |
| Sequence | HAib-EGTFTSDVSSYLEGQAAKEFIAWLVRGRG (31-aa GLP-1 analog with α-aminoisobutyric acid substitution at position 2 and C18 fatty di-acid modification at K20) |
| Appearance | White lyophilized powder |
| Storage | Lyophilized: -20°C. Reconstituted: refrigerated, use within 30 days. |
Certificates of Analysis
Batch PLACEHOLDER-2026-A
Lot PC-SEMA-2026-001 · Janoshik Analytical · 1/14/2026
99.3%
purity
Research Notes
Semaglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist consisting of 31 amino acids. Two structural modifications distinguish it from native GLP-1: substitution of alanine with α-aminoisobutyric acid at position 2, and attachment of a C18 fatty di-acid via a linker at lysine 20, which enables albumin binding.
Research interest
Semaglutide has been extensively investigated for:
- GLP-1 receptor pharmacology and downstream signaling
- Pharmacokinetic effect of albumin-binding modifications on half-life
- Comparison against other GLP-1 analogs (liraglutide, dulaglutide)
- Dual receptor agonist comparisons (see Tirzepatide)
References
- PubMed query for Semaglutide
- Lau J, et al. Discovery of the Once-Weekly Glucagon-Like Peptide-1 (GLP-1) Analogue Semaglutide. J Med Chem. 2015.
This product is sold for laboratory and research use only. It is not intended for human consumption, in vitro diagnostic use, therapeutic use, or veterinary use.
All products sold on this site are intended strictly for laboratory and research use only. They are NOT intended for human consumption, in vitro diagnostic use, therapeutic use, or veterinary use. By purchasing from Paradise Compounds, you affirm that you are a qualified researcher and agree to use these materials in accordance with all applicable federal, state, and local laws.